Jump to content

Neuromedin B

From Wikipedia, the free encyclopedia
NMB
Identifiers
AliasesNMB, Neuromedin B, Neuromedin-B, Neuromedin-Beta
External IDsOMIM: 162340; MGI: 1915289; GeneCards: NMB
Available structures
PDBOrtholog search: D4A1W6 PDBe D4A1W6 RCSB
Orthologs
DatabasesNCBI: entry; OMA: entry
SpeciesHumanMouse
Entrez
Ensembl
UniProt
RefSeq (mRNA)

NM_205858
NM_021077

NM_001291280
NM_026523

RefSeq (protein)

NP_066563
NP_995580
NP_001102619

NP_001278209
NP_080799

Location (UCSC)Chr 15: 84.66 – 84.66 MbChr 7: 80.55 – 80.55 Mb
PubMed search[3][4]
Wikidata
View/Edit HumanView/Edit Mouse
neuromedin B
Identifiers
SymbolNMB
NCBI gene4828
HGNC7842
OMIM162340
RefSeqNM_021077
UniProtP08949
Other data
LocusChr. 15 q11-qter
Search for
StructuresSwiss-model
DomainsInterPro

Neuromedin B (NMB) is a bombesin-related peptide in mammals.[5][6] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[7]

Sequence

[edit]

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[8] The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.

Function

[edit]
Figure 1: NMB, 7-TMR receptor and G-protein
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level
  • sneezing[9]

Neuromedin signaling pathway

[edit]

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α inactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.

References

[edit]
  1. 1 2 3 GRCh38: Ensembl release 89: ENSG00000197696 Ensembl, May 2017
  2. 1 2 3 GRCm38: Ensembl release 89: ENSMUSG00000025723 Ensembl, May 2017
  3. "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. Ohki-Hamazaki H (October 2000). "Neuromedin B". Progress in Neurobiology. 62 (3): 297–312. doi:10.1016/S0301-0082(00)00004-6. PMID 10840151. S2CID 23673653.
  6. Jensen RT, Battey JF, Spindel ER, Benya RV (March 2008). "International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states". Pharmacological Reviews. 60 (1): 1–42. doi:10.1124/pr.107.07108. PMC 2517428. PMID 18055507.
  7. Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (September 1988). "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin". The Journal of Biological Chemistry. 263 (26): 13317–23. doi:10.1016/S0021-9258(18)37707-X. PMID 2458345.
  8. Wada E, Way J, Lebacq-Verheyden AM, Battey JF (September 1990). "Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system". The Journal of Neuroscience. 10 (9): 2917–30. doi:10.1523/JNEUROSCI.10-09-02917.1990. PMC 6570249. PMID 2398368.
  9. Li F, Jiang H, Shen X, Yang W, Guo C, Wang Z, et al. (June 2021). "Sneezing reflex is mediated by a peptidergic pathway from nose to brainstem". Cell. 184 (14): 3762–3773.e10. doi:10.1016/j.cell.2021.05.017. PMC 8396370. PMID 34133943. S2CID 235430434.
[edit]